PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_023090_ietn.t1
Common NameSOVF_023090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 25312.1 Da    PI: 9.6412
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_023090_ietn.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.74.9e-31959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien+s rqvtfskRrng+lKKA+ELSvLCdaeva+iifs+tgklye++s
  Sp_023090_ietn.t1  9 KRIENDSSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPTGKLYEFAS 59
                       79***********************************************86 PP

2K-box65.51.8e-2284176799
              K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                        ++++++++ + +++++ L+k++++L+ ++R+llG++Les+s+ eLq Le+qL+ksl++iR+kKn l++ qi++l + ek l +en +L++kl
  Sp_023090_ietn.t1  84 SKVSDRNMLQFKEDANELEKKLKSLELSKRRLLGDSLESCSIDELQDLEKQLDKSLSTIRAKKNALFKVQIDKLYEEEKLLLKENARLKEKL 175
                        3388999999********************************************************************************99 PP

              K-box  99 e 99 
                        +
  Sp_023090_ietn.t1 176 Q 176
                        7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.5E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.777161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.89E-32377IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-30323IPR002100Transcription factor, MADS-box
CDDcd002652.34E-40375No hitNo description
PfamPF003194.4E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-303859IPR002100Transcription factor, MADS-box
PfamPF014866.5E-2290175IPR002487Transcription factor, K-box
PROSITE profilePS5129712.7491181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MVRGKTQMKR IENDSSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP TGKLYEFASS  60
RCCSTSRTID RYQKHMKELR GVKSKVSDRN MLQFKEDANE LEKKLKSLEL SKRRLLGDSL  120
ESCSIDELQD LEKQLDKSLS TIRAKKNALF KVQIDKLYEE EKLLLKENAR LKEKLQNSLP  180
VPLSVRQPTD DDQRNNVQDD VETELFIGLP ESRNSRCLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A7e-18360259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B7e-18360259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C7e-18360259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D7e-18360259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A8e-18360259Myocyte-specific enhancer factor 2A
3kov_B8e-18360259Myocyte-specific enhancer factor 2A
3kov_I8e-18360259Myocyte-specific enhancer factor 2A
3kov_J8e-18360259Myocyte-specific enhancer factor 2A
3mu6_A6e-18360259Myocyte-specific enhancer factor 2A
3mu6_B6e-18360259Myocyte-specific enhancer factor 2A
3mu6_C6e-18360259Myocyte-specific enhancer factor 2A
3mu6_D6e-18360259Myocyte-specific enhancer factor 2A
3p57_A8e-18360259Myocyte-specific enhancer factor 2A
3p57_B8e-18360259Myocyte-specific enhancer factor 2A
3p57_C8e-18360259Myocyte-specific enhancer factor 2A
3p57_D8e-18360259Myocyte-specific enhancer factor 2A
3p57_I8e-18360259Myocyte-specific enhancer factor 2A
3p57_J8e-18360259Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818952e-49LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132632e-49LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010676581.11e-110PREDICTED: agamous-like MADS-box protein AGL19
SwissprotQ9XJ608e-74MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLA0A0K9RW271e-156A0A0K9RW27_SPIOL; Uncharacterized protein
STRINGSolyc08g080100.2.11e-74(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-53AGAMOUS-like 20